PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bradi3g10067.3.p
Common NameBRADI_3g10067, LOC100845090
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family MYB
Protein Properties Length: 323aa    MW: 36129.4 Da    PI: 5.8909
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bradi3g10067.3.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding55.31.5e-17851145
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
   Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45
                      r +W++eE e+l + v+++G+++W tIa+ ++ gR++ qc+ rw+
  Bradi3g10067.3.p  8 RVKWSEEENEILTQMVNKHGMKNWQTIAHAIP-GRSAQQCRQRWR 51
                      789*****************************.***********8 PP

2Myb_DNA-binding39.51.3e-1260102145
                       TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
   Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 
                       + +W+++E+++l++a++ +G++ W+   ++++ gRt   +k++w+
  Bradi3g10067.3.p  60 KEAWSQQEELRLIRAHQIYGTK-WREMVKHFP-GRTNGALKDYWR 102
                       579*******************.*********.***********7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129418.968158IPR017930Myb domain
SuperFamilySSF466892.27E-257101IPR009057Homeodomain-like
SMARTSM007178.8E-16756IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.1E-201063IPR009057Homeodomain-like
CDDcd001676.06E-161051No hitNo description
PfamPF139211.3E-151171No hitNo description
PROSITE profilePS5129414.48659109IPR017930Myb domain
SMARTSM007177.1E-1059107IPR001005SANT/Myb domain
CDDcd001671.71E-962102No hitNo description
Gene3DG3DSA:1.10.10.602.9E-1564109IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 323 aa     Download sequence    Send to blast
MNSEGNARVK WSEEENEILT QMVNKHGMKN WQTIAHAIPG RSAQQCRQRW RYKVDSAINK  60
EAWSQQEELR LIRAHQIYGT KWREMVKHFP GRTNGALKDY WRGPMKRKLD SYLASGLLEQ  120
LPDVLENMSV PQNSDSDILN ETEGLFDRNE LPSGQPTSSK SKPVLTERGE SADMSEGKNA  180
DFMYVRAVDA HSANAPQKII VRSEQHARTR RKLDILSSPV ELKVSTVAVN SERPLQKKEQ  240
MGPAVSGIDP SNGCLDISPE VPSQYANTLV SPNGSYQPND VHSAGTSDPC SPELDISDLM  300
EMSYFDSFMI FPPDSPHDGN SL*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A2e-231111110110B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010234128.10.0PREDICTED: myb-related protein B-like isoform X1
RefseqXP_010234127.10.0PREDICTED: myb-related protein B-like isoform X1
TrEMBLA0A0Q3F4510.0A0A0Q3F451_BRADI; Uncharacterized protein
STRINGBRADI3G10067.10.0(Brachypodium distachyon)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G11510.16e-41myb domain protein 3r-4